MrVIA precursor (P06268) Protein Card

General Information
Name MrVIA precursor
Alternative name(s) Mr_precursor_143
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MMIVAVLFLTAWTLVMA
DDSNNGLANHFSKSRDEMEDPEAS
KLEER
ACRKKWEYCIVPIIGFIYCCPGLICGPFVCV
Sequence region
[1-17]signal sequence
[47-77]mature peptideMrVIA

References
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J., Taft,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies BMC Genomics 14:708

Internal links
Nucleic acids Conus marmoreus mRNA for Mr_precursor_143, complete cds.
Structure

External links
Ncbi BAO02217

Tools