Mr146 precursor (P06269) Protein Card

General Information
Name Mr146 precursor
Alternative name(s) Mr_precursor_146
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MMIVAVLFLTAWTFVMA
DDPRDGPDTAVRGGKRFWKARNEM
NSAASKLNKR
ECLEADYYCVLPFVGNGMCCSGICVFVCIAQ
KYKTVVTSSTPLCATWLDL
Sequence region
[1-17]signal sequence
[52-101]mature peptideMr146

References
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J., Taft,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies BMC Genomics 14:708

Internal links
Nucleic acids Conus marmoreus mRNA for Mr_precursor_146, complete cds.
Structure

External links
Ncbi BAO02220

Tools