Vc6.22 precursor (P06329) Protein Card

General Information
Name Vc6.22 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLFVAVVLMSTQA
LPQGGGEKRPRENIRFLSKRKS
NAER
WREGNCTPWLATCTNAPQCCTGVCYKRAYCALWE
Sequence region
[1-19]signal sequence
[46-79]mature peptideVc6.22

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae O2_Vc6.22 mRNA sequence.
Structure

External links
Ncbi JAB84652

Tools