Vc6.31 precursor (P06345) Protein Card

General Information
Name Vc6.31 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMA
DDSNNGLANHFWKSRDEME
DPEASKLEKR
DCQDKWEFCIVPILGFVYCCPGLICGPFVCV
Sequence region
[1-22]signal sequence
[52-82]mature peptideVc6.31

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae O1_Vc6.31 mRNA sequence.
Structure

External links
Ncbi JAB84668

Tools