Vc12.1 precursor (P06372) Protein Card

General Information
Name Vc12.1 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily I2 superfamily
Pharmacological family

Sequence
MSGHTSVSFLLLSIVALGMVATVIC
SCDSEFSSEFCERPEE
SCSCLTHSCCHWSRRDQCMTPQRCISAQKGN
GRRRLTHMQK
Sequence region
[1-25]signal sequence
[26-72]mature peptideVc12.1

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae I4_Vc12.1 mRNA sequence.
Structure

External links
Ncbi JAB84695

Tools