conodipine-Vc3 alpha chain precursor (P06388) Protein Card

General Information
Name conodipine-Vc3 alpha chain precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MFVLGLSMMLAVAGRVVMG
VDPCAQYANGCSVPLHMPLFYK
TLFTPSCNRHDVCYRCGAKYGISKDTCDSAFLHHMEAACAV
HDASRRHISLQSSSSSSASHLQKRSACTVFAKDVFYEAVHI
FGGLFYHDVDGTASFCSEPTAVSCLHD
Sequence region
[1-19]signal sequence
[20-150]mature peptideconodipine-Vc3 alpha chain

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae Conodipine_Vc3 mRNA sequence.
Structure

External links
Ncbi JAB84711

Tools