Conodipine-Vc1 precursor (P06390) Protein Card

General Information
Name Conodipine-Vc1 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conodipine
Gene superfamily
Pharmacological family

Sequence
MKMLESALWILAALALPWIAAQDS
RTDELCKINSNGCSVPS
SWIPCQQHFLAACDRHDTCYMCGAHFSLTQKDCDDAFLVHM
TALCGHGTDDEGFCLEKR
KRREASSMSITTPLIQLRLLEKH
MPLNSLWDHDSR
QPQQRYIYDNCTDWALTYYNTVQRFGWWY
FYDTANATYCPQFEPCMPEVSSSA
Sequence region
[1-24]signal sequence
[25-100]mature peptideConodipine-Vc1 alpha chain
[136-188]mature peptideConodipine-Vc1 beta chain

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae Conodipine_Vc1 mRNA sequence.
Structure

External links
Ncbi JAB84713

Tools