conantokin-Vc1 precursor (P06392) Protein Card

General Information
Name conantokin-Vc1 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MQLYTHLCLLVPLVTLYLILGTGTLA
HGGALTERRLAHAR
A
MEPDPVLLQKFAARSTDDNGKDRMTQRKRILKKRGNTARGA
KEDRNNAEAVRERLEEI
GKR
Sequence region
[1-26]signal sequence
[41-99]mature peptideconantokin-Vc1

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae Conantokin_Vc1 mRNA sequence.
Structure

External links
Ncbi JAB84715

Tools