Co1.2 (P06416) Protein Card

General Information
Name Co1.2
Organism Conus coronatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Co1.2 precursor (6027)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
EDCCFIDDCWASHPEACGGGMELLRQDPLNRDMPPSA
Sequence evidence nucleic acid level
Average Mass 4076.50
Monoisotopic Mass 4073.66
Isoelectric Point 4.28
Extinction Coefficient [280nm] 5500.00

References

Internal links
Protein Precursor Co1.2 precursor (6027)
Nucleic acids
Structure

External links

Tools