Lv1.9 (P06425) Protein Card

General Information
Name Lv1.9
Organism Conus lividus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lv1.9 precursor (6036)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
NTAAKVKYSKTQEECCPNPPCFAVNSALCGA
Sequence evidence nucleic acid level
Average Mass 3241.67
Monoisotopic Mass 3239.45
Isoelectric Point 9.68
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Lv1.9 precursor (6036)
Nucleic acids
Structure

External links

Tools