Ec1.7 (P06518) Protein Card

General Information
Name Ec1.7
Organism Conus emaciatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ec1.7 precursor (6146)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
YAAVVNRASALMAQAVLRDCCSNPPCAHNIHCA
Sequence evidence nucleic acid level
Average Mass 3466.99
Monoisotopic Mass 3464.58
Isoelectric Point 10.83
Extinction Coefficient [280nm] 1490.00

References
Wu,Y., Wang,L., Zhou,M., You,Y., Zhu,X., Qiang,Y., Qin,M., Luo,S., Ren,Z. and Xu,A. (2013) Molecular evolution and diversity of Conus peptide toxins, as revealed by gene structure and intron sequence analyses. PLoS ONE 8

Internal links
Protein Precursor Ec1.7 precursor (6146)
Nucleic acids
Structure

External links

Tools