Mr114 (P06557) Protein Card

General Information
Name Mr114
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr114 precursor (6252)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DDECEPPGVFCGTFKIGPPCCSGWCFLWCDLKLP
Sequence evidence nucleic acid level
Average Mass 3758.34
Monoisotopic Mass 3755.57
Isoelectric Point 4.33
Extinction Coefficient [280nm] 11000.00

References
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J., Taft,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies BMC Genomics 14:708

Internal links
Protein Precursor Mr114 precursor (6252)
Nucleic acids
Structure

External links

Tools