contryphan-Vc1 (P06615) Protein Card

General Information
Name contryphan-Vc1 (named by ConoServer)
Alternative name(s) O2_Vc1
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor contryphan Vc1 precursor (6335)
Notes Predicted by ConoServer from protein precursor. This peptide was qualified to be a contryphan conopeptide, but the sequence does not display the allmarks of the contryphans, which usually have an inter-cysteine segment of only five residues and at least one tryptophan residue. ConoServer therefore did not classified this peptide as contryphan.

Classification
Conopeptide class contryphan
Gene superfamily O2 superfamily
Pharmacological family

Sequence
QWCQPGYAYNPVLGICTITLSRIEHPGNYDY
Sequence evidence nucleic acid level
Average Mass 3571.00
Monoisotopic Mass 3568.65
Isoelectric Point 7.10
Extinction Coefficient [280nm] 11460.00

Synthetic variants
contryphan-Vc1[1-22]RSLTITCIGLVPNYAYGPQCWQ

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor contryphan Vc1 precursor (6335)
Nucleic acids
Structure Solution NMR structure of Contryphan-Vc1

External links

Tools