Vc6.37 (P06620) Protein Card

General Information
Name Vc6.37
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Vc6.37 precursor (6340)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KCMEQGTYCSLILFSSSCCGDLCLFGFCIL
Sequence evidence nucleic acid level
Average Mass 3279.88
Monoisotopic Mass 3277.38
Isoelectric Point 5.63
Extinction Coefficient [280nm] 1490.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor Vc6.37 precursor (6340)
Nucleic acids
Structure

External links

Tools