Vc6.34 (P06623) Protein Card

General Information
Name Vc6.34
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Vc6.34 precursor (6343)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ASRLNKSCHLGGEYCGLFEVCCYGDCFIMCW
Sequence evidence nucleic acid level
Average Mass 3503.04
Monoisotopic Mass 3500.40
Isoelectric Point 6.85
Extinction Coefficient [280nm] 8480.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor Vc6.34 precursor (6343)
Nucleic acids
Structure

External links

Tools