F_Vc1 (P06657) Protein Card

General Information
Name F_Vc1
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor F_Vc1 precursor (6386)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class unclassified
Gene superfamily F superfamily
Pharmacological family

Sequence
KLMDTCAKANHYIADRWSTYRIEYLEDKGLYHRMLRELVPC
LNNFLRTRQEAP
Sequence evidence nucleic acid level
Average Mass 6442.43
Monoisotopic Mass 6438.22
Isoelectric Point 10.75
Extinction Coefficient [280nm] 11460.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor F_Vc1 precursor (6386)
Nucleic acids
Structure

External links

Tools