Conodipine-Vc1 alpha chain (P06661) Protein Card

General Information
Name Conodipine-Vc1 alpha chain
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Conodipine-Vc1 precursor (6390)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conodipine
Gene superfamily
Pharmacological family

Sequence
RTDELCKINSNGCSVPSSWIPCQQHFLAACDRHDTCYMCGA
HFSLTQKDCDDAFLVHMTALCGHGTDDEGFCLEKR
Sequence evidence nucleic acid level
Average Mass 8476.45
Monoisotopic Mass 8470.61
Isoelectric Point 6.14
Extinction Coefficient [280nm] 6990.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor Conodipine-Vc1 precursor (6390)
Nucleic acids
Structure

External links

Tools