conodipine-Vc3 alpha chain (P06663) Protein Card

General Information
Name conodipine-Vc3 alpha chain
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor conodipine-Vc3 alpha chain precursor (6388)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VIII
Pharmacological family

Sequence
VDPCAQYANGCSVPLHMPLFYKTLFTPSCNRHDVCYRCGAK
YGISKDTCDSAFLHHMEAACAVHDASRRHISLQSSSSSSAS
HLQKRSACTVFAKDVFYEAVHIFGGLFYHDVDGTASFCSEP
TAVSCLHD
Sequence evidence nucleic acid level
Average Mass 14334.04
Monoisotopic Mass 14324.51
Isoelectric Point 7.53
Extinction Coefficient [280nm] 8940.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor conodipine-Vc3 alpha chain precursor (6388)
Nucleic acids
Structure

External links

Tools