TsMEKL-03 (P06667) Protein Card

General Information
Name TsMEKL-03
Organism Conus tessulatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor TsMEKL-03 precursor (701)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KTTAESWWEGECYGWWTSCSSPEQCCSLNCENIYCRAW
Sequence evidence nucleic acid level
Average Mass 4492.89
Monoisotopic Mass 4489.74
Isoelectric Point 5.06
Extinction Coefficient [280nm] 30480.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor TsMEKL-03 precursor (701)
Nucleic acids
Structure

External links

Tools