ArMLKMS-01 (P06668) Protein Card

General Information
Name ArMLKMS-01
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor ArMLKMS-01 precursor (790)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IV
Pharmacological family

Sequence
MGFILSALRQQECCVYPFCDGGCYTCQDSCE
Sequence evidence nucleic acid level
Average Mass 3464.89
Monoisotopic Mass 3462.32
Isoelectric Point 4.94
Extinction Coefficient [280nm] 2980.00

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Protein Precursor ArMLKMS-01 precursor (790)
Nucleic acids
Structure

External links

Tools