Mi017 precursor (P06696) Protein Card

General Information
Name Mi017 precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MKLTCALIITLLFLSITAG
DSRGKHRYNALKSMSREANSTE
R
ECREKGQGCTNTALCCPGLECEGQSQGGLCVDNKWRLMFP
LGALSCAA
Sequence region
[1-19]signal sequence
[43-90]mature peptideMi017

References
Jin,A.H., Dutertre,S., Kaas,Q., Lavergne,V., Kubala,P. and Alewood,P.F. (2013) Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity. Mol. Cell Proteomics 12:3824-3833

Internal links
Nucleic acids Conus miles conopeptide Mi017 mRNA, complete cds.
Structure

External links
Ncbi AKB91355

Tools