Ml15b precursor (P06713) Protein Card

General Information
Name Ml15b precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTVLILVATVLLTIQVLG
QSDRDKHLKRRPRQYATKRL
SALMKGHR
QCTGAGFECEETPECCPNLTCKCSGSPLCTRYR
CKT
Sequence region
[1-21]signal sequence
[50-85]mature peptideMl15b

References
Jin,A.H., Dutertre,S., Kaas,Q., Lavergne,V., Kubala,P. and Alewood,P.F. (2013) Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity. Mol. Cell Proteomics 12:3824-3833

Internal links
Nucleic acids Conus miles conopeptide Mi035 mRNA, complete cds.
Structure

External links
Ncbi AKB91373

Tools