Mi047 precursor (P06724) Protein Card

General Information
Name Mi047 precursor
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MGILTVLLPLVAVLVLTQVIVRS
DQDKPLNRRRNIREAQAL
RR
VRDCNIQEDACESNDDCCLGLFCKNEVCEYASP
GRRAVE
NRAALIRENKP
Sequence region
[1-23]signal sequence
[44-76]mature peptideMi047

References
Jin,A.H., Dutertre,S., Kaas,Q., Lavergne,V., Kubala,P. and Alewood,P.F. (2013) Transcriptomic messiness in the venom duct of Conus miles contributes to conotoxin diversity. Mol. Cell Proteomics 12:3824-3833

Internal links
Nucleic acids Conus miles conopeptide Mi048 mRNA, complete cds.
Structure

External links
Ncbi AKB91386

Tools