Glycoprotein hormone alpha-2 prepropeptide (P06728) Protein Card

General Information
Name Glycoprotein hormone alpha-2 prepropeptide
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
MGRRDSGRAVAQRYRGVTRGVTVIACLMVVCACVGLCDATG
QKRHSWEAPGCHLVGHTRVVRIPDCVPFQITTNACRGFCVS
YAIPSPYQTLVYNPNHIITSRAACCDIIDTLDIPVQVTCVD
GVREIVFKSARSCACSICRRE

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Nucleic acids TSA: Conus victoriae Glycoprotein_hormone_alpha-2 mRNA sequence.
Structure

External links
Ncbi JAI08984

Tools