insulin-like peptide-1 prepropeptide (P06729) Protein Card

General Information
Name insulin-like peptide-1 prepropeptide
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor
Notes Cleavage sites estimated based on sequence alignment with other insulins.

Classification
Conopeptide class coninsulin
Gene superfamily
Pharmacological family

Sequence
MTTSSYFLLVALGLLLYVCQS
SFGGEHVCWLDDPNHPEGIC
GPQVSDIVEIRCEEKEAEQGGANNARAYTGR
TSSLMKRRGF
LSLLKKRGKRDEGSLQRSGR
GIVCECCKHHCTKEELTEYCH
Sequence region
[1-21]signal sequence
[22-72]mature peptideB-chain?
[73-102]pro region
[103-123]mature peptideA-chain

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S., Safavi-Hemami,H. (2015) Hormone-like peptides in the venoms of marine cone snails Gen. Comp. Endocrinol. [In press, corrected proof]

Internal links
Nucleic acids TSA: Conus victoriae insulin-like_peptide-1 mRNA sequence.
insulin-like peptide-1 mRNA
Structure

External links
Ncbi JAI08985

Tools