prohormone-4-Vc1 precursor (P06730) Protein Card

General Information
Name prohormone-4-Vc1 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class prohormone-4
Gene superfamily
Pharmacological family

Sequence
MSSPLRMDVTFLLAAIAVTWVCG
LK
IGFPGFSTPPR
SFIQH
PKR
TLCPEDCDIASPFKCEESPTCLRLFQVCNGRWDCEHGS
DEDNALCAAVLR
PLECMIWEFLEGQRDWILPNLFNDANTDL
VAHALHEAYSMGDLQSYLNLTDQNIENIRNSTRGAIVGDPR
PLMALGMPDRAWPEVMYLLKELYNLGLDVWAE
Sequence evidence protein level
Sequence region
[1-23]signal sequence
[26-36]mature peptideprohormone-4-Vc1
[45-94]pro regionLDL receptor Class A domain
[95-196]pro region

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Nucleic acids TSA: Conus victoriae prohormone-4 mRNA sequence.
prohormone-4 mRNA
Structure

External links
Ncbi A0A0F7YYX3, JAI08986

Tools