GeXXA (P06732) Protein Card

General Information
Name GeXXA
Alternative name(s) Ge-5
Organism Conus generalis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor GeXXA precursor (6678)
GeXXA precursor (8210)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family alpha conotoxin

Sequence
PCQSVRPGRVWGKCCLTRLCSTMCCARADCTCVYHTWRGHG
CSCVM
Sequence evidence nucleic acid level
Average Mass 5117.01
Monoisotopic Mass 5113.12
Isoelectric Point 12.69
Extinction Coefficient [280nm] 12490.00

Activity

IC50: Nicotinic acetylcholine receptors

TargetOrganismIC50nhillAgonistRef
α1β1δεR. norvegicus743 nM-1.6ACh (50uM)Xu,S. et al. (2015)
α3β2R. norvegicus498 nM-3.5ACh (5uM)Xu,S. et al. (2015)
α3β4R. norvegicus614 nM-1.6ACh (50uM)Xu,S. et al. (2015)
α4β2R. norvegicus>3 uMACh (50uM)Xu,S. et al. (2015)
α4β4R. norvegicus>3 uM-0.9ACh (50um)Xu,S. et al. (2015)
α7H. sapiens210 nM-2.2ACh (200uM)Xu,S. et al. (2015)
α9α10H. sapiens28 nM-1.3ACh (50uM)Xu,S. et al. (2015)
R. norvegicus1.2 nM-1.9ACh (50uM)Xu,S. et al. (2015)
synthetic construct(Mutant receptor at position 7 of sequence (L7H))3.3 nM-3.6ACh (50uM)Xu,S. et al. (2015)
(Hybrid of human alpha-9 and rat alpha-10)1.1 nM-1.6ACh (50uM)Xu,S. et al. (2015)

Synthetic variants
GeXXA-CTDMVCSCGHGRWTHYVCTCDARACCMTSCLRT

References
Xu,S., Zhang,T., Kompella,S.N., Yan,M., Lu,A., Wang,Y., Shao,X., Chi,C., Adams,D.J., Ding,J. and Wang,C. (2015) Conotoxin αD-GeXXA utilizes a novel strategy to antagonize nicotinic acetylcholine receptors. Sci Rep 5:14261
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor GeXXA precursor (6678)
GeXXA precursor (8210)
Nucleic acids
Structure Dimeric conotoxin alphaD-GeXXA

External links

Tools