Mi005 (P06736) Protein Card

General Information
Name Mi005
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi005 precursor (6684)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECREKGQGCTNTAFCCPGLECEGQSQGGLCVDN
Sequence evidence nucleic acid level
Average Mass 3431.72
Monoisotopic Mass 3429.33
Isoelectric Point 4.33
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Mi005 precursor (6684)
Nucleic acids
Structure

External links

Tools