Mi016 (P06747) Protein Card

General Information
Name Mi016
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi016 precursor (6695)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECREKGQGCTNTALCCPGLECEGQSQGGCAWTIKWRLMFPL
GALSCAA
Sequence evidence nucleic acid level
Average Mass 5073.82
Monoisotopic Mass 5070.23
Isoelectric Point 6.78
Extinction Coefficient [280nm] 11125.00

References

Internal links
Protein Precursor Mi016 precursor (6695)
Nucleic acids
Structure

External links

Tools