Mi018 (P06749) Protein Card

General Information
Name Mi018
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi018 precursor (6697)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ECREKGQGCTNAALCCPGLECEARVKVVCAWTIKWRLMFPL
GALSCAA
Sequence evidence nucleic acid level
Average Mass 5182.14
Monoisotopic Mass 5178.44
Isoelectric Point 10.13
Extinction Coefficient [280nm] 11125.00

References

Internal links
Protein Precursor Mi018 precursor (6697)
Nucleic acids
Structure

External links

Tools