Mi026 (P06756) Protein Card

General Information
Name Mi026
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi026 precursor (6704)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CTDSGQFCDPTNHDCCSGNCIDEGGNGVCAFVREDVPKLY
Sequence evidence nucleic acid level
Average Mass 4264.59
Monoisotopic Mass 4261.66
Isoelectric Point 4.62
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Mi026 precursor (6704)
Nucleic acids
Structure

External links

Tools