Mi034 (P06764) Protein Card

General Information
Name Mi034
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi034 precursor (6712)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
SSDEECVGLSGYCGPWNNPPCCSWWECEVYCAVPGPSF
Sequence evidence nucleic acid level
Average Mass 4153.53
Monoisotopic Mass 4150.57
Isoelectric Point 4.32
Extinction Coefficient [280nm] 19480.00

References

Internal links
Protein Precursor Mi034 precursor (6712)
Nucleic acids
Structure

External links

Tools