Mi039 (P06766) Protein Card

General Information
Name Mi039
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi039 precursor (6716)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Cysteine framework XX
Pharmacological family

Sequence
DAQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYCIYHRGR
GHGCSC
Sequence evidence nucleic acid level
Average Mass 5123.86
Monoisotopic Mass 5120.05
Isoelectric Point 12.08
Extinction Coefficient [280nm] 8480.00

References

Internal links
Protein Precursor Mi039 precursor (6716)
Nucleic acids
Structure

External links

Tools