Mi044 (P06769) Protein Card

General Information
Name Mi044
Organism Conus miles
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Mi044 precursor (6720)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XIII
Pharmacological family

Sequence
PECYNCFPNDDGHCVGTCCGEDSCKGGIRGCGCV
Sequence evidence nucleic acid level
Average Mass 3491.81
Monoisotopic Mass 3489.21
Isoelectric Point 5.07
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Mi044 precursor (6720)
Nucleic acids
Structure

External links

Tools