Sa6.1 precursor (P06836) Protein Card

General Information
Name Sa6.1 precursor
Organism Conus sanguinolentus
Organism region Indo-Pacific
Protein Type Precursor
Notes Sequence homology to SuVIA - may possibly have an essential role in prey capture or defence (Jin et al., 2015)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTFVTA
DDSKNELENRGGWEPFPEA
R
DEMKNPKAFELTECSSYGEFCFPGIKDCCMGYCFIMCLPT
SPHD
Sequence region
[1-22]signal sequence
[23-42]pro region
[43-86]mature peptideSa6.1

References
Jin,A.H., Israel,M.R., Inserra,M.C., Smith,J.J., Lewis,R.J., Alewood,P.F., Vetter,I. and Dutertre,S. (2015) δ-Conotoxin SuVIA suggests an evolutionary link between ancestral predator defence and the origin of fish-hunting behaviour in carnivorous cone snails. Proc. Biol. Sci. 282

Internal links
Nucleic acids
Structure

External links

Tools