Ml6.6 (P06838) Protein Card

General Information
Name Ml6.6 (named by ConoServer)
Alternative name(s) Mi6.2
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ml6.6 precursor (6840)
Notes Sequence homology to SuVIA - may possibly have an essential role in prey capture or defence (Jin et al., 2015)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
NFCHPIGEPCFPKQFIPCCSGVCDVVCRGIF
Average Mass 3411.02
Monoisotopic Mass 3408.48
Isoelectric Point 7.82
Extinction Coefficient [280nm] 2980.00

References
Jin,A.H., Israel,M.R., Inserra,M.C., Smith,J.J., Lewis,R.J., Alewood,P.F., Vetter,I. and Dutertre,S. (2015) δ-Conotoxin SuVIA suggests an evolutionary link between ancestral predator defence and the origin of fish-hunting behaviour in carnivorous cone snails. Proc. Biol. Sci. 282

Internal links
Protein Precursor Ml6.6 precursor (6840)
Nucleic acids
Structure

External links

Tools