Ml6.7 (P06841) Protein Card

General Information
Name Ml6.7 (named by ConoServer)
Alternative name(s) mi6.3
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ml6.7 precursor (6842)
Notes Sequence homology to SuVIA - may possibly have an essential role in prey capture or defence (Jin et al., 2015)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
NFCHPVGEPCFIGQIIPCCSGVCDVVCRGVFYSP
Sequence evidence nucleic acid level
Average Mass 3641.24
Monoisotopic Mass 3638.57
Isoelectric Point 6.60
Extinction Coefficient [280nm] 1490.00

References
Jin,A.H., Israel,M.R., Inserra,M.C., Smith,J.J., Lewis,R.J., Alewood,P.F., Vetter,I. and Dutertre,S. (2015) δ-Conotoxin SuVIA suggests an evolutionary link between ancestral predator defence and the origin of fish-hunting behaviour in carnivorous cone snails. Proc. Biol. Sci. 282

Internal links
Protein Precursor Ml6.7 precursor (6842)
Nucleic acids
Structure

External links

Tools