thyrostimulin-alpha 2 precursor (P06868) Protein Card

General Information
Name thyrostimulin-alpha 2 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class thyrostimulin
Gene superfamily
Pharmacological family

Sequence
MGRRDSGRAVAQRYRGVTRGVTVIACLMVVCACVGLCDATG
QKSILGSPGCHLVGHTRVVRIPDCVPFQITTNACRGFCVSY
AIPSPYQTLVYNPNHIITSRAACCDIIDTLDIPVQVTCVDG
VREIVFKSARSCACSIC
RRE
Sequence evidence nucleic acid level
Sequence region
[1-41]signal sequence
[42-140]mature peptidethyrostimulin-alpha 2

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Nucleic acids thyrostimulin-alpha 2 mRNA
Structure

External links
Ncbi A0A0F7Z3J2

Tools