thyrostimulin-beta 5 precursor (P06869) Protein Card

General Information
Name thyrostimulin-beta 5 precursor
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class thyrostimulin
Gene superfamily
Pharmacological family

Sequence
MPLVLSLALTPPPLCHA
TLVDPR
TTLQCHVRSYTFRATKPP
IVNENGDPVTCQGDVRVSSCWGRCDSSEIGDYKMPFKISNH
PVCTYTGRVSRTVRLSQCAGYPDPTVQVFDATGCACQFCNS
ETQLCEKLN
G
Sequence evidence nucleic acid level
Sequence region
[1-17]signal sequence
[24-132]mature peptidethyrostimulin-beta 5

References
Robinson,S.D., Li,Q., Bandyopadhyay,P.K., Gajewiak,J., Yandell,M., Papenfuss,A.T., Purcell,A.W., Norton,R.S. and Safavi-Hemami,H. (2017) Hormone-like peptides in the venoms of marine cone snails. Gen. Comp. Endocrinol. 244:11-18

Internal links
Nucleic acids thyrostimulin-beta 5 mRNA
Structure

External links

Tools