Vn6.1 precursor (P00691) Protein Card

General Information
Name Vn6.1 precursor
Alternative name(s) VnMEKL-0221
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAAVLMWTQA
LIQEKRPKEKIKFLSKR
KTTAE
SWWEGECSGWSVYCTQHSECCSGECTGNYCELF
Sequence region
[1-19]signal sequence
[37-74]mature peptideVn6.1

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus ventricosus clone VnMEKL-0221 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPD0
Ncbi AAG60432, Q9BPD0

Tools