Vn6.5 precursor (P00696) Protein Card

General Information
Name Vn6.5 precursor
Alternative name(s) VnMEKL-024
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MQKLTILLLVAAVLMSTQA
LIRGGVEKRQEAKRNFFSKR
KT
TAESWWEGECRTWYAPCNFPSQCCSEVCSSKTGRCLTW
Sequence region
[1-19]signal sequence
[40-79]mature peptideVn6.5

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus ventricosus clone VnMEKL-024 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPC5
Ncbi AAG60437, Q9BPC5

Tools