Vn6.6 precursor (P00697) Protein Card

General Information
Name Vn6.6 precursor
Alternative name(s) VnMEKL-0111
Organism Conus ventricosus
Organism region Eastern Atlantic and Mediterranean
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MKLTILFLVAAVLMSTQA
LIQHDGEKSQKAKMKFLTARTLS
AKTR
GVDCVGLSSYCGPWNNPPCCSWYTCDYYCKF
Sequence region
[1-18]signal sequence
[46-76]mature peptideVn6.6

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus ventricosus clone VnMEKL-0111 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPC4
Ncbi AAG60438, Q9BPC4

Tools