TxMEKL-011 precursor (P00704) Protein Card

General Information
Name TxMEKL-011 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAAVLMSTQA
LVERAGENRSKENIKFLLKRKR
AADR
GMWGKCKDGLTTCLAPSECCSGNCEQNCKMW
Sequence region
[1-19]signal sequence
[46-76]mature peptideTxMEKL-011

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus textile clone TxMEKL-011 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPB7
Ncbi AAG60445, Q9BPB7

Tools