Vx109 precursor (P07040) Protein Card

General Information
Name Vx109 precursor
Organism Conus vexillum
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily D superfamily
Pharmacological family

Sequence
MPKLAVVLLVLLILPLSYFDVGGQA
EQGDWRGNRLARDLQR
GGR
DDESECIINTRDSPWGRCCRTRMCGSMCCPRNGCTCVY
HWRRGHGCSCP
G
Sequence evidence nucleic acid level
Sequence region
[1-25]signal sequence
[26-44]pro region
[45-93]mature peptideVxXXB

References
Prashanth,J.R., Dutertre,S., Jin,A.H., Lavergne,V., Hamilton,B., Cardoso,F.C., Griffin,J., Venter,D.J., Alewood,P.F. and Lewis,R.J. (2016) The role of defensive ecological interactions in the evolution of conotoxins. Mol. Ecol. 25:598-615

Internal links
Nucleic acids
Structure

External links

Tools