Ar6.15 precursor (P00744) Protein Card

General Information
Name Ar6.15 precursor
Alternative name(s) ArMKLT2-032
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIIAVLFLTACQLTTG
ETYSRGEQKDHALRSTDKN
SKLTR
QCTPVGGYCFDHHHCCSNHCIKSIGRCVAH
Sequence region
[1-22]signal sequence
[47-76]mature peptideAr6.15

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus arenatus clone ArMKLT2-032 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BP81
Ncbi AAG60485, Q9BP81

Tools