Cyclic PVIIA (P07500) Protein Card

General Information
Name Cyclic PVIIA
Organism synthetic construct
Protein Type Synthetic
Parent PVIIA

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CRIONQKCFQHLDDCCSRKCNRFNKCVLPETGGG
Modified residues
positionsymbolname
4O4-Hydroxyproline
Average Mass 3863.41
Monoisotopic Mass 3860.70
Isoelectric Point 11.80
Extinction Coefficient [280nm] NA

References
Kwon,S., Bosmans,F., Kaas,Q., Cheneval,O., Conibear,A.C., Rosengren,K.J., Wang,C.K., Schroeder,C.I. and Craik,D.J. (2016) Efficient enzymatic cyclization of an inhibitory cystine knot-containing peptide. Biotechnol. Bioeng. 113:2202-2212

Internal links
Nucleic acids
Structure Three-dimensional structure of cyclic PVIIA

External links

Tools