Cono-NPY2 (P07537) Protein Card

General Information
Name Cono-NPY2
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conoNPY
Gene superfamily
Pharmacological family

Sequence
TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY(nh2)
Modified residues
positionsymbolname
38nh2C-term amidation
Sequence evidence protein level
Average Mass 4364.02
Monoisotopic Mass 4361.26
Isoelectric Point 11.07
Extinction Coefficient [280nm] 4470.00

References
Wu,X., Shao,X., Guo,Z.Y. and Chi,C.W. (2010) Identification of neuropeptide Y-like conopeptides from the venom of Conus betulinus. Acta Biochim. Biophys. Sin. (Shanghai) 42:502-505

Internal links
Nucleic acids
Structure

External links

Tools