Ar6.22 precursor (P00755) Protein Card

General Information
Name Ar6.22 precursor
Alternative name(s) ArMSGL-0123
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATKRAAVNFRWRR
SFTRR
AAAEECEEYCEEEEKTCCGEEDGEPVCAEFCL
G
Sequence region
[1-20]signal sequence
[47-78]mature peptideAr6.22

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus arenatus clone ArMSGL-0123 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BP70
Ncbi AAG60496, Q9BP70

Tools