Ar6.26 precursor (P00760) Protein Card

General Information
Name Ar6.26 precursor
Alternative name(s) ArMSGL-0143
Organism Conus arenatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMLLTLLLLVFMETSHQ
DAGEKQATQRDAINVRRRR
SLTRR
VTEECEENCEEEEKHCCNTNNGPSCAPQCF
G
Sequence region
[1-22]signal sequence
[47-76]mature peptideAr6.26

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus arenatus clone ArMSGL-0143 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BP65
Ncbi AAG60501, Q9BP65

Tools