VilXIVA precursor (P07651) Protein Card

General Information
Name VilXIVA precursor (named by ConoServer)
Organism Conus villepinii
Organism region Western Atlantic and Caribbean
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily R superfamily
Pharmacological family

Sequence
MGFRVLVLVVMATTSALPFTFS
EEPGRSPFRPALRSEEAQA
LRHGLTLLLARRADGQPPDMRQPEMRRPEVRRPEVRQPEFA
ETPVGQKR
GGLGRCIYNCMNSGGGLSFIQCKTMC
Sequence region
[1-22]signal sequence
[91-116]mature peptideVilXIVA

References

Internal links
Nucleic acids
Structure

External links
Ncbi MH750032

Tools